Recombinant E.coli 30S ribosomal protein S11 protein

Product Type: Recombinant protein
Product Name: Recombinant E.coli 30S ribosomal protein S11 protein
Alias:
Code: CSB-RP087574Ba
Size: 1mg/500ug/200ug/50ug/10ug
Relevance: Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome
Mol Weight: 21 KD
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Tested Applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0?200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA Sequence: AKAPIRARKRVRKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAAQVAAERCA
DAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDVTPIPHNGCRPPKKRRV
References: [1] "Nucleotide sequence of the alpha ribosomal protein operon of Escherichia coli." Bedwell D.M., Davis G.R., Gosink M., Post L.E., Nomura M., Kestler H., Zengel J.M., Lindahl L. Nucleic Acids Res. 13:3891-3903(1985) [PubMed: 2989779] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. Strain: K12. [2] "The complete genome sequence of Escherichia coli K-12." Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1474(1997) [PubMed: 9278503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / MG1655 / ATCC 47076. [3] "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006) [PubMed: 16738553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / W3110 / ATCC 27325 / DSM 5911. [4] "Primary structure of protein S11 from Escherichia coli ribosomes." Kamp R., Wittmann-Liebold B. FEBS Lett. 121:117-122(1980) [PubMed: 7007074] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-129. Strain: K. [5] "Photochemical cross-linking of initiation factor-3 to Escherichia coli 30 S ribosomal subunits." MacKeen L.A., Kahan L., Wahba A.J., Schwartz I. J. Biol. Chem. 255:10526-10531(1980) [PubMed: 7000779] [Abstract] Cited for: CROSS-LINKING TO IF-3. Strain: B.