Recombinant E.coli 30S ribosomal protein S19 protein

Product Type: Recombinant protein
Product Name: Recombinant E.coli 30S ribosomal protein S19 protein
Alias:
Code: CSB-RP086774Ba
Size: 1mg/500ug/200ug/50ug/10ug
Relevance: In the E.coli 70S ribosome in the initiation state (Ref.10) it has been modeled to contact the 23S rRNA of the 50S subunit forming part of bridge B1a; this bridge is broken in the model with bound EF-G. The 23S rRNA contact site in bridge B1a is modeled t
Mol Weight: 16 KD
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Tested Applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0?200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA Sequence: PRSLKKGPFIDLHLLKKVEKAVESGDKKPLRTWSRRSTIFPNMIGLTIAVHNGRQHVPVFVTDEMVGHKL
GEFAPTRTYRGHAADKKAKKK
References: [1] "Structure of the Escherichia coli S10 ribosomal protein operon." Zurawski G., Zurawski S.M. Nucleic Acids Res. 13:4521-4526(1985) [PubMed: 3892488] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. [2] "The complete genome sequence of Escherichia coli K-12." Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1474(1997) [PubMed: 9278503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / MG1655 / ATCC 47076. [3] "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006) [PubMed: 16738553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / W3110 / ATCC 27325 / DSM 5911. [4] "Primary structure of protein S19 from the small ribosomal subunit of Escherichia coli." Yaguchi M., Wittmann H.G. FEBS Lett. 88:227-230(1978) [PubMed: 348496] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-92. Strain: K. [5] "Identification of a cross-link in the Escherichia coli ribosomal protein pair S13-S19 at the amino acid level." Pohl T., Wittmann-Liebold B. J. Biol. Chem. 263:4293-4301(1988) [PubMed: 3279034] [Abstract] Cited for: PROTEIN SEQUENCE OF 66-70, CROSS-LINKING TO S13. Strain: K12 / A19.