Recombinant E.coli 30S ribosomal protein S7 protein

Product Type: Recombinant protein
Product Name: Recombinant E.coli 30S ribosomal protein S7 protein
Alias:
Code: CSB-RP085974Ba
Size: 1mg/500ug/200ug/50ug/10ug
Relevance: One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, where it has been shown to contact mRNA. Has been
Mol Weight: 27 KD
Product Info: HIS-tagged
Source: E.coli derived
Purity: 90%
Tested Applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0?200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA Sequence: PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLAQRSGKSELEAFEVALENVRP
TVEVKSRRVGGSTYQVPVEVRPVRRNALAMRWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDV
HRMAEANKAFAHYRWLSLRSFSHQAGASSKQPALGYLN
References: [1] "The complete genome sequence of Escherichia coli K-12." Blattner F.R., Plunkett G. III, Bloch C.A., Perna N.T., Burland V., Riley M., Collado-Vides J., Glasner J.D., Rode C.K., Mayhew G.F., Gregor J., Davis N.W., Kirkpatrick H.A., Goeden M.A., Rose D.J., Mau B., Shao Y. Science 277:1453-1474(1997) [PubMed: 9278503] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / MG1655 / ATCC 47076. [2] "Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110." Hayashi K., Morooka N., Yamamoto Y., Fujita K., Isono K., Choi S., Ohtsubo E., Baba T., Wanner B.L., Mori H., Horiuchi T. Mol. Syst. Biol. 2:E1-E5(2006) [PubMed: 16738553] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: K12 / W3110 / ATCC 27325 / DSM 5911. [3] "The primary structure of ribosomal protein S7 from E. coli strains K and B." Reinbolt J., Tritsch D., Wittmann-Liebold B. Biochimie 61:501-522(1979) [PubMed: 385062] [Abstract] Cited for: PROTEIN SEQUENCE OF 2-179. Strain: B and K. [4] "DNA sequences from the str operon of Escherichia coli." Post L.E., Nomura M. J. Biol. Chem. 255:4660-4666(1980) [PubMed: 6989816] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-81 AND 148-179. Strain: K12. [5] "Mutant sequences in the rpsL gene of Escherichia coli B/r: mechanistic implications for spontaneous and ultraviolet light mutagenesis." Timms A.R., Steingrimsdottir H., Lehmann A.R., Bridges B.A. Mol. Gen. Genet. 232:89-96(1992) [PubMed: 1552908] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1-81. Strain: B/R.