Recombinant Chicken Doublecortin protein

Product Type: Recombinant protein
Product Name: Recombinant Chicken Doublecortin protein
Alias:
Code: CSB-RP151974c
Size: 1mg/500ug/200ug/50ug/10ug
Relevance: Probable kinase that may be involved in a calcium-signaling pathway controlling neuronal migration in the developing brain. May also participate in functions of the mature nervous system.
Mol Weight: 46.5KD
Product Info: His tagged
Source: E.coli derived
Purity: 90%
Tested Applications: SDS-PAGE, ELISA
Storage Buffer: 20mM Tris-Hcl, 0.5M NaCl, 10% glycerin, PH 8.0?200 mM Imidazole
Storage: Store at -20?, for extended storage, conserve at -20? or -80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
AA Sequence: MELDFGHFDERDKASRNMRGTRMNGLPSPTHSAHCSFYRTRTLQALSNEKKAKKVRFYRNGDRYFKGIVY
AVSSDRFRSFDALLADLTRSLSDNINLPQGVRYIYTIDGSRKIGSMDELEEGESYVCSSDNFFKKVEYTK
NVNPNWSVNVKTSANQKAPQSLASSNSAQAKENKDFVRPKLVTIIRSGVKPRKAVRVLLN
References: 1] "Screening from a subtracted embryonic chick hindbrain cDNA library: identification of genes expressed during hindbrain, midbrain and cranial neural crest development." Christiansen J.H., Coles E.G., Robinson V., Pasini A., Wilkinson D.G. Mech. Dev. 102:119-133(2001) [PubMed: 11287186] [Abstract] Cited for: NUCLEOTIDE SEQUENCE.