Diagnostics, Instrumentation and Biomedical Solutions
Call 301-770-2448
Recombinant Bovine Tumor necrosis factor protein
Applications
Request Price Quote
Product Type: | Recombinant protein |
---|---|
Product Name: | Recombinant Bovine Tumor necrosis factor protein |
Alias: | Cachectin,TNF-alpha,Tumor necrosis factor ligand superfamily member 2,TNF-a |
Code: | CSB-RP084794B |
Size: | 1mg/500ug/200ug/50ug/10ug |
Relevance: | Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is i |
Mol Weight: | 23 KD |
Product Info: | His tagged |
Source: | E.coli derived |
Purity: | 95% |
Tested Applications: | SDS-PAGE, ELISA |
Storage Buffer: | PBS buffer |
Storage: | Store at -20?, for extended storage, conserve at -20? or -80?. |
Notes: | Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week. |
AA Sequence: | LRSSSQASSNKPVAHVVADINSPGQLRWWDSYANALMANGVKLEDNQLVVPADGLYLIYSQVLFRGQGCP STPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETPEWAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPD YLDYAESGQVYFGIIAL |
References: | [1] "Cloning of two members of the TNF-superfamily in cattle: CD40 ligand and tumor necrosis factor alpha." Mertens B.E.L.C., Muriuki M., Gaidulis L. Immunogenetics 42:430-431(1995) [PubMed: 7590981] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-233 (ISOFORM 1). Tissue: Blood. [2] "Rapid communication: single strand conformational polymorphism (SSCP) of bovine tumor necrosis factor alpha." Dietz A.B., Neibergs H.L., Womack J.E., Kehrli M.E. Jr. J. Anim. Sci. 75:2567-2567(1997) [PubMed: 9303477] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 91-193. Strain: Holstein. |